PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01704.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 601aa    MW: 65537.5 Da    PI: 7.9252
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01704.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32293350260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       dDgynWrKYGqK+vkgse+prsYY+Ct+a+Cpvkkkvers+ +++++ei+Y+g H+h+k
  Migut.H01704.1.p 293 DDGYNWRKYGQKQVKGSEYPRSYYKCTHANCPVKKKVERSH-EGHITEIIYKGAHKHPK 350
                       8****************************************.***************85 PP

2WRKY1048.4e-33424482159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+++d k v++tYeg+Hnh+
  Migut.H01704.1.p 424 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCNVRKHVERASHDLKSVITTYEGKHNHD 482
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.088287351IPR003657WRKY domain
SuperFamilySSF1182901.26E-25290351IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-28291351IPR003657WRKY domain
SMARTSM007743.5E-35292350IPR003657WRKY domain
PfamPF031066.9E-25293349IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-37409484IPR003657WRKY domain
SuperFamilySSF1182901.31E-28416484IPR003657WRKY domain
PROSITE profilePS5081138.572419484IPR003657WRKY domain
SMARTSM007747.4E-38424483IPR003657WRKY domain
PfamPF031065.0E-25425482IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MGVFDDHVAI MGDWMPPSPS PRSLFSSTNN NVAFERSIAD PSGEIKTGPV YGNADHNFPV  60
NSNALTEQKT SFRGGLMERM AARAGFNAPR LNTESSPCLT IPPGLSPTSL LDSPVFLSNS  120
LAQPSPTTGK FAFAPPSGNY WGPTLLNGEV SSKANKTNNF EDNQSFAFKP IQESGSFPCF  180
NYMDKVTFGV ATNNFPAEMH QSVEESRKIQ TLSNSHSKSN NNSEGGGGNL SPEQTYQSVG  240
GGAANLSPEQ TYQSVGGGGT NNSPPLDEPL PHQEDGDQRI GGGDAVAGGT LADDGYNWRK  300
YGQKQVKGSE YPRSYYKCTH ANCPVKKKVE RSHEGHITEI IYKGAHKHPK PPPNRRSSLG  360
PPSNEEEDDR VTHGSVSLGC DGEGEELESK RRRIENYASE VSGASRAIRE PRVVVQTTSE  420
VDILDDGYRW RKYGQKVVKG NPNPRSYYKC TSTGCNVRKH VERASHDLKS VITTYEGKHN  480
HDVPMARNSS HVNSGGAPTH PLPNTHQQPQ SGSSVSNHMQ RPDMNMTRFE RPPSMGSFNF  540
PHVGPGPGFG FGSGFVNHQY LGHQLRPMNS MGFMLPKMEP EWNLLLASTR LMDRRLISSL  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36291484877Probable WRKY transcription factor 4
2lex_A4e-36291484877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1389393KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841853.10.0PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 2
TrEMBLA0A022R0J40.0A0A022R0J4_ERYGU; Uncharacterized protein
STRINGGSMUA_Achr4P01600_0011e-147(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.16e-85WRKY family protein